UEVLD Antibody - middle region (ARP57194_P050)

Data Sheet
 
Product Number ARP57194_P050
Product Page www.avivasysbio.com/uevld-antibody-middle-region-arp57194-p050.html
Name UEVLD Antibody - middle region (ARP57194_P050)
Protein Size (# AA) 379 amino acids
Molecular Weight 42kDa
NCBI Gene Id 55293
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name UEV and lactate/malate dehyrogenase domains
Alias Symbols ATTP, UEV3
Peptide Sequence Synthetic peptide located within the following region: SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target UEVLD is a possible negative regulator of polyubiquitination.
Protein Interactions UBC; DTX3; LRSAM1; RNF114; TRAF6; RNF4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UEVLD (ARP57194_P050) antibody
Blocking Peptide For anti-UEVLD (ARP57194_P050) antibody is Catalog # AAP57194 (Previous Catalog # AAPP40843)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UEVLD
Uniprot ID A8MYV4
Protein Name Ubiquitin-conjugating enzyme E2 variant 3 Ensembl ENSP00000379499
Sample Type Confirmation

UEVLD is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_060784
Purification Affinity Purified
Nucleotide Accession # NM_018314
Tested Species Reactivity Human
Gene Symbol UEVLD
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 91%; Pig: 92%; Rabbit: 93%; Rat: 93%
Image 1
Human 721_B
WB Suggested Anti-UEVLD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateUEVLD is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com