PANK4 Antibody - middle region (ARP57156_P050)

Data Sheet
 
Product Number ARP57156_P050
Product Page www.avivasysbio.com/pank4-antibody-middle-region-arp57156-p050.html
Name PANK4 Antibody - middle region (ARP57156_P050)
Protein Size (# AA) 773 amino acids
Molecular Weight 86kDa
NCBI Gene Id 55229
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pantothenate kinase 4
Alias Symbols DKFZp547M242, FLJ10782
Peptide Sequence Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference 0
Description of Target This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt
Protein Interactions EGFR; TP53RK; EFTUD1; OSGEP; NSUN2; TERF2IP; UFM1; EEF2K; KIAA1279; ACTR2; SAE1; UBE3C; TPD52L2; RANGAP1; BAG1; CDK20; UBC; C18orf8; PTPN6; PEA15;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PANK4 (ARP57156_P050) antibody
Blocking Peptide For anti-PANK4 (ARP57156_P050) antibody is Catalog # AAP57156 (Previous Catalog # AAPP40808)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PANK4
Uniprot ID Q9NVE7
Protein Name Pantothenate kinase 4
Protein Accession # NP_060686
Purification Affinity Purified
Nucleotide Accession # NM_018216
Tested Species Reactivity Human
Gene Symbol PANK4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-PANK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com