NECAP2 Antibody - N-terminal region (ARP57111_P050)

Data Sheet
 
Product Number ARP57111_P050
Product Page www.avivasysbio.com/necap2-antibody-n-terminal-region-arp57111-p050.html
Name NECAP2 Antibody - N-terminal region (ARP57111_P050)
Protein Size (# AA) 263 amino acids
Molecular Weight 28kDa
NCBI Gene Id 55707
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NECAP endocytosis associated 2
Alias Symbols FLJ10420, RP4-798A10.1
Peptide Sequence Synthetic peptide located within the following region: WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gregory,S.G., (2006) Nature 441 (7091), 315-321
Description of Target This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.
Protein Interactions FN1; HSPA8; APP; EPS15; AP2M1; UBC; PLSCR1; NMI; TRAF2; AP2B1; GGA1; GGA2; AP1G1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NECAP2 (ARP57111_P050) antibody
Blocking Peptide For anti-NECAP2 (ARP57111_P050) antibody is Catalog # AAP57111 (Previous Catalog # AAPP40705)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NECAP2
Uniprot ID Q9NVZ3
Protein Name Adaptin ear-binding coat-associated protein 2
Protein Accession # NP_060560
Purification Affinity Purified
Nucleotide Accession # NM_018090
Tested Species Reactivity Human
Gene Symbol NECAP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 86%
Image 1
Human MCF-7
WB Suggested Anti-NECAP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com