| Product Number |
ARP57075_P050-HRP |
| Product Page |
www.avivasysbio.com/wipi1-antibody-n-terminal-region-hrp-arp57075-p050-hrp.html |
| Name |
WIPI1 Antibody - N-terminal region : HRP (ARP57075_P050-HRP) |
| Protein Size (# AA) |
446 amino acids |
| Molecular Weight |
49kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
55062 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain, phosphoinositide interacting 1 |
| Alias Symbols |
ATG18, ATG18A, WIPI49 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Description of Target |
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su |
| Protein Interactions |
ESR1; AR; ATG2A; HNRNPA3P1; PKP1; LGALS7; KCTD15; ESR2; PPA1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-WIPI1 (ARP57075_P050-HRP) antibody |
| Blocking Peptide |
For anti-WIPI1 (ARP57075_P050-HRP) antibody is Catalog # AAP57075 (Previous Catalog # AAPP40619) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human WIPI1 |
| Uniprot ID |
Q5MNZ9 |
| Protein Name |
WD repeat domain phosphoinositide-interacting protein 1 |
| Protein Accession # |
NP_060453 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017983 |
| Gene Symbol |
WIPI1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | |
|
