Ppp2r3c Antibody - N-terminal region (ARP57063_P050)

Data Sheet
 
Product Number ARP57063_P050
Product Page www.avivasysbio.com/ppp2r3c-antibody-n-terminal-region-arp57063-p050.html
Name Ppp2r3c Antibody - N-terminal region (ARP57063_P050)
Protein Size (# AA) 453 amino acids
Molecular Weight 49kDa
Subunit B''
NCBI Gene Id 362739
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein phosphatase 2, regulatory subunit B'', gamma
Alias Symbols RGD1309207
Peptide Sequence Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Ppp2r3c (ARP57063_P050) antibody
Blocking Peptide For anti-Ppp2r3c (ARP57063_P050) antibody is Catalog # AAP57063
Uniprot ID Q6AXZ3
Protein Name Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
Protein Accession # NP_001014218
Purification Affinity Purified
Nucleotide Accession # NM_001014196
Tested Species Reactivity Rat
Gene Symbol Ppp2r3c
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Rat Brain
WB Suggested Anti-Ppp2r3c Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com