OTUB1 Antibody - middle region (ARP57000_P050)

Data Sheet
 
Product Number ARP57000_P050
Product Page www.avivasysbio.com/otub1-antibody-middle-region-arp57000-p050.html
Name OTUB1 Antibody - middle region (ARP57000_P050)
Protein Size (# AA) 271 amino acids
Molecular Weight 31kDa
NCBI Gene Id 55611
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name OTU domain, ubiquitin aldehyde binding 1
Alias Symbols OTB1, OTU1, HSPC263
Peptide Sequence Synthetic peptide located within the following region: KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Juris,S.J., (2006) FEBS Lett. 580 (1), 179-183
Description of Target The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin
Protein Interactions UBE2D4; ERN1; UBE2D3; UBC; SUMO2; TRAF3; NEDD8; SUMO1; NMRAL1; TP53; UBE2D1; RNF2; KDM1A; UBE2N; SMAD4; SMAD3; SMAD2; TNFSF12; BIRC3; BIRC2; SMAD9; ESR1; ACTB; UBE2D2; RNF126; ECT2; OTUD6B; DSTN; RFFL; TRIM63; TRIM55; PJA1; USP28; TRIM54; USP21; USP15; UB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OTUB1 (ARP57000_P050) antibody
Blocking Peptide For anti-OTUB1 (ARP57000_P050) antibody is Catalog # AAP57000 (Previous Catalog # AAPP39943)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human OTUB1
Uniprot ID Q96FW1
Protein Name Ubiquitin thioesterase OTUB1
Sample Type Confirmation

OTUB1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

Protein Accession # NP_060140
Purification Affinity Purified
Nucleotide Accession # NM_017670
Tested Species Reactivity Human
Gene Symbol OTUB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-OTUB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.OTUB1 is strongly supported by BioGPS gene expression data to be expressed in HepG2
Image 2
Human HEK293T
Host: Rabbit
Target Name: OTUB1
Sample Type: 293T
Antibody Dilution: 1.0ug/mlOTUB1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com