| Product Number |
ARP56945_P050 |
| Product Page |
https://www.avivasysbio.com/rasl12-antibody-n-terminal-region-arp56945-p050.html |
| Name |
RASL12 Antibody - N-terminal region (ARP56945_P050) |
| Protein Size (# AA) |
266 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
51285 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RAS-like, family 12 |
| Alias Symbols |
RIS |
| Peptide Sequence |
Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pulverer,B.J., (2005) Science 307 (5715), 1621-1625 |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
APP; SMURF2; BMPR1B; SMAD3; SMAD1; SMAD2; SMAD4; TGFBR1; ACVR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RASL12 (ARP56945_P050) antibody |
| Blocking Peptide |
For anti-RASL12 (ARP56945_P050) antibody is Catalog # AAP56945 (Previous Catalog # AAPP39134) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RASL12 |
| Uniprot ID |
Q9NYN1 |
| Protein Name |
Ras-like protein family member 12 |
| Protein Accession # |
NP_057647 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016563 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RASL12 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-RASL12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate |
|
|
