| Product Number |
ARP56939_P050 |
| Product Page |
www.avivasysbio.com/ier5-antibody-n-terminal-region-arp56939-p050.html |
| Name |
IER5 Antibody - N-terminal region (ARP56939_P050) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
51278 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Immediate early response 5 |
| Alias Symbols |
SBBI48 |
| Peptide Sequence |
Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
| Description of Target |
This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene |
| Protein Interactions |
AICDA; UBD; PPP2R2B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IER5 (ARP56939_P050) antibody |
| Blocking Peptide |
For anti-IER5 (ARP56939_P050) antibody is Catalog # AAP56939 (Previous Catalog # AAPP39129) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human IER5 |
| Uniprot ID |
Q5VY09 |
| Protein Name |
Immediate early response gene 5 protein |
| Publications |
Robinson, P. M. et al. Proteolytic processing of connective tissue growth factor in normal ocular tissues and during corneal wound healing. Invest. Ophthalmol. Vis. Sci. 53, 8093-103 (2012). 23139278 |
| Protein Accession # |
NP_057629 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016545 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IER5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 77%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-IER5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
