| Product Number |
ARP56908_P050-Biotin |
| Product Page |
www.avivasysbio.com/glrx5-antibody-middle-region-biotin-arp56908-p050-biotin.html |
| Name |
GLRX5 Antibody - middle region : Biotin (ARP56908_P050-Biotin) |
| Protein Size (# AA) |
157 amino acids |
| Molecular Weight |
16kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
51218 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glutaredoxin 5 |
| Alias Symbols |
GRX5, PRSA, SIDBA3, SPAHGC, FLB4739, PR01238, PRO1238, C14orf87 |
| Peptide Sequence |
Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Camaschella,C., (2007) Blood 110 (4), 1353-1358 |
| Description of Target |
Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known. |
| Protein Interactions |
KEAP1; APP; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-GLRX5 (ARP56908_P050-Biotin) antibody |
| Blocking Peptide |
For anti-GLRX5 (ARP56908_P050-Biotin) antibody is Catalog # AAP56908 (Previous Catalog # AAPP34105) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GLRX5 |
| Uniprot ID |
Q86SX6 |
| Protein Name |
Glutaredoxin-related protein 5, mitochondrial |
| Protein Accession # |
NP_057501 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016417 |
| Gene Symbol |
GLRX5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
