| Product Number |
ARP56908_P050 |
| Product Page |
www.avivasysbio.com/glrx5-antibody-middle-region-arp56908-p050.html |
| Name |
GLRX5 Antibody - middle region (ARP56908_P050) |
| Protein Size (# AA) |
157 amino acids |
| Molecular Weight |
16kDa |
| NCBI Gene Id |
51218 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glutaredoxin 5 |
| Alias Symbols |
GRX5, PRSA, SIDBA3, SPAHGC, FLB4739, PR01238, PRO1238, C14orf87 |
| Peptide Sequence |
Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Camaschella,C., (2007) Blood 110 (4), 1353-1358 |
| Description of Target |
Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known. |
| Protein Interactions |
KEAP1; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GLRX5 (ARP56908_P050) antibody |
| Blocking Peptide |
For anti-GLRX5 (ARP56908_P050) antibody is Catalog # AAP56908 (Previous Catalog # AAPP34105) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GLRX5 |
| Uniprot ID |
Q86SX6 |
| Protein Name |
Glutaredoxin-related protein 5, mitochondrial |
| Protein Accession # |
NP_057501 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016417 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GLRX5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-GLRX5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
| Image 2 | Human THP-1 Whole Cell
 | Host: Rabbit
Target Name: GLRX5
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 3 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: GLRX5
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 4 | MCF7, A549
 | Host: Rabbit
Target: GLRX5
Positive control (+): MCF7 (N10)
Negative control (-): A549 (N03)
Antibody concentration: 5ug/ml |
|
