CAB39 Antibody - middle region (ARP56877_P050)

• Product Number: ARP56877_P050
• Name: CAB39 Antibody - middle region (ARP56877_P050)
• Protein Size (# AA): 341 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 51719
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Calcium binding protein 39
• Alias Symbols: MO25, CGI-66
• Peptide Sequence: Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Description of Target: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
• Protein Interactions: UBC; IQCB1; VCP; VPS26B; STK11; STRADA; STRADB; PRKAA1; EBLN2; TIMM13; MOB4; BCKDK; CUL2; VHL; RAD51;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CAB39 (ARP56877_P050) antibody is Catalog # AAP56877 (Previous Catalog # AAPP39823)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAB39
• Uniprot ID: Q9Y376
• Protein Name: Calcium-binding protein 39
• Protein Accession #: NP_057373
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016289
• Tested Species Reactivity: Human
• Gene Symbol: CAB39
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
• Image 1: Human Liver
  
  WB Suggested Anti-CAB39 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Liver