TUBE1 Antibody - middle region (ARP56869_P050)

Data Sheet
 
Product Number ARP56869_P050
Product Page www.avivasysbio.com/tube1-antibody-middle-region-arp56869-p050.html
Name TUBE1 Antibody - middle region (ARP56869_P050)
Protein Size (# AA) 475 amino acids
Molecular Weight 53kDa
NCBI Gene Id 51175
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tubulin, epsilon 1
Alias Symbols TUBE, dJ142L7.2
Peptide Sequence Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35
Description of Target This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization
Protein Interactions UBC; IGSF8; ICAM1; CD81;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TUBE1 (ARP56869_P050) antibody
Blocking Peptide For anti-TUBE1 (ARP56869_P050) antibody is Catalog # AAP56869 (Previous Catalog # AAPP39816)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TUBE1
Uniprot ID Q9UJT0
Protein Name Tubulin epsilon chain
Protein Accession # NP_057346
Purification Affinity Purified
Nucleotide Accession # NM_016262
Tested Species Reactivity Human, Fruit fly
Gene Symbol TUBE1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 85%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Drosophila Melanogaster brain
Drosophila Melanogaster brain
Image 2
Human HeLa
WB Suggested Anti-TUBE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com