Product Number |
ARP56869_P050 |
Product Page |
www.avivasysbio.com/tube1-antibody-middle-region-arp56869-p050.html |
Name |
TUBE1 Antibody - middle region (ARP56869_P050) |
Protein Size (# AA) |
475 amino acids |
Molecular Weight |
53kDa |
NCBI Gene Id |
51175 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tubulin, epsilon 1 |
Alias Symbols |
TUBE, dJ142L7.2 |
Peptide Sequence |
Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35 |
Description of Target |
This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization |
Protein Interactions |
UBC; IGSF8; ICAM1; CD81; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TUBE1 (ARP56869_P050) antibody |
Blocking Peptide |
For anti-TUBE1 (ARP56869_P050) antibody is Catalog # AAP56869 (Previous Catalog # AAPP39816) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TUBE1 |
Uniprot ID |
Q9UJT0 |
Protein Name |
Tubulin epsilon chain |
Protein Accession # |
NP_057346 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016262 |
Tested Species Reactivity |
Human, Fruit fly |
Gene Symbol |
TUBE1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 85%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Drosophila Melanogaster brain
| Drosophila Melanogaster brain |
| Image 2 | Human HeLa
| WB Suggested Anti-TUBE1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate |
|
|