HSD17B14 Antibody - middle region (ARP56865_P050)

Data Sheet
 
Product Number ARP56865_P050
Product Page www.avivasysbio.com/hsd17b14-antibody-middle-region-arp56865-p050.html
Name HSD17B14 Antibody - middle region (ARP56865_P050)
Protein Size (# AA) 270 amino acids
Molecular Weight 28kDa
NCBI Gene Id 51171
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hydroxysteroid (17-beta) dehydrogenase 14
Alias Symbols DHRS10, SDR47C1, retSDR3
Peptide Sequence Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lukacik,P., (2007) Biochem. J. 402 (3), 419-427
Description of Target 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
Protein Interactions MIR4435-1HG; SREK1IP1; LINC00152; TBC1D22B; WDYHV1; HSD17B14; NEK6; SNRPC; SNAPC3; PHF1; MPG; DDIT3; CDKN2D; CA8; NUDT18; PSMA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HSD17B14 (ARP56865_P050) antibody
Blocking Peptide For anti-HSD17B14 (ARP56865_P050) antibody is Catalog # AAP56865 (Previous Catalog # AAPP35432)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSD17B14
Uniprot ID Q9BPX1
Protein Name 17-beta-hydroxysteroid dehydrogenase 14
Protein Accession # NP_057330
Purification Affinity Purified
Nucleotide Accession # NM_016246
Tested Species Reactivity Human
Gene Symbol HSD17B14
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Liver
WB Suggested Anti-HSD17B14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com