NLK Antibody - middle region (ARP56863_P050)

Data Sheet
 
Product Number ARP56863_P050
Product Page www.avivasysbio.com/nlk-antibody-middle-region-arp56863-p050.html
Name NLK Antibody - middle region (ARP56863_P050)
Protein Size (# AA) 527 amino acids
Molecular Weight 58kDa
NCBI Gene Id 51701
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nemo-like kinase
Alias Symbols DKFZp761G1211, FLJ21033
Peptide Sequence Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Protein Interactions KRTAP5-6; KRTAP10-3; KRTAP4-2; QRICH1; ZHX3; KRTAP5-9; GRN; TP53; MDM2; STAT5A; LEF1; CNOT2; SMAD4; KPNB1; BACH1; TNKS1BP1; FAM222A; C2orf44; CEP97; RNF219; FAM222B; CNOT11; NLK; PASK; SHANK2; UBAP2L; CCP110; TRPS1; TLE3; SKI; RANGAP1; RANBP2; PKM; CNOT3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NLK (ARP56863_P050) antibody
Blocking Peptide For anti-NLK (ARP56863_P050) antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NLK
Uniprot ID Q9UBE8
Protein Name Serine/threonine-protein kinase NLK
Protein Accession # NP_057315
Purification Affinity Purified
Nucleotide Accession # NM_016231
Tested Species Reactivity Human
Gene Symbol NLK
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Human 293T
WB Suggested Anti-NLK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com