| Product Number |
ARP56814_P050 |
| Product Page |
https://www.avivasysbio.com/prelid3b-antibody-n-terminal-region-arp56814-p050.html |
| Name |
PRELID3B Antibody - N-terminal region (ARP56814_P050) |
| Protein Size (# AA) |
194 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
51012 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
PRELI domain containing 3B |
| Alias Symbols |
SLMO2, C20orf45, dJ543J19.5 |
| Peptide Sequence |
Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRELID3B (ARP56814_P050) antibody |
| Blocking Peptide |
For anti-PRELID3B (ARP56814_P050) antibody is Catalog # AAP56814 (Previous Catalog # AAPP39723) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2 |
| Uniprot ID |
A5GFX0 |
| Protein Name |
PRELI domain containing protein 3B |
| Protein Accession # |
NP_057129 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016045 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRELID3B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Stomach
 | WB Suggested Anti-SLMO2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach |
|
|
