PRELID3B Antibody - N-terminal region (ARP56814_P050)

Data Sheet
 
Product Number ARP56814_P050
Product Page https://www.avivasysbio.com/prelid3b-antibody-n-terminal-region-arp56814-p050.html
Name PRELID3B Antibody - N-terminal region (ARP56814_P050)
Protein Size (# AA) 194 amino acids
Molecular Weight 21kDa
NCBI Gene Id 51012
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PRELI domain containing 3B
Alias Symbols SLMO2, C20orf45, dJ543J19.5
Peptide Sequence Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein Interactions UBC; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRELID3B (ARP56814_P050) antibody
Blocking Peptide For anti-PRELID3B (ARP56814_P050) antibody is Catalog # AAP56814 (Previous Catalog # AAPP39723)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2
Uniprot ID A5GFX0
Protein Name PRELI domain containing protein 3B
Protein Accession # NP_057129
Purification Affinity Purified
Nucleotide Accession # NM_016045
Tested Species Reactivity Human
Gene Symbol PRELID3B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-SLMO2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach