PGM3 Antibody - middle region (ARP56756_P050)

Data Sheet
 
Product Number ARP56756_P050
Product Page www.avivasysbio.com/pgm3-antibody-middle-region-arp56756-p050.html
Name PGM3 Antibody - middle region (ARP56756_P050)
Protein Size (# AA) 542 amino acids
Molecular Weight 60kDa
NCBI Gene Id 5238
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Phosphoglucomutase 3
Alias Symbols AGM1, PAGM, IMD23, PGM 3
Peptide Sequence Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mungall,A.J., (2003) Nature 425 (6960), 805-811
Description of Target PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.
Protein Interactions UBC; DCP2; NEDD8; BAG3; APP; SPRTN; CUL3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PGM3 (ARP56756_P050) antibody
Blocking Peptide For anti-PGM3 (ARP56756_P050) antibody is Catalog # AAP56756 (Previous Catalog # AAPP39613)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PGM3
Uniprot ID O95394
Protein Name Phosphoacetylglucosamine mutase
Sample Type Confirmation

PGM3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_056414
Purification Affinity Purified
Nucleotide Accession # NM_015599
Tested Species Reactivity Human
Gene Symbol PGM3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-PGM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysatePGM3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com