C22orf28 Antibody - N-terminal region (ARP56745_P050)

• Product Number: ARP56745_P050
• Name: C22orf28 Antibody - N-terminal region (ARP56745_P050)
• Protein Size (# AA): 505 amino acids
• Molecular Weight: 55 kDa
• NCBI Gene Id: 51493
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chromosome 22 open reading frame 28
• Alias Symbols: FAAP, HSPC117, C22orf28, DJ149A16.6
• Peptide Sequence: Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318
• Description of Target: The function of this protein remains unknown.
• Protein Interactions: UBC; FUS; SUMO1; NEDD8; MDM2; BMI1; rev; HNRNPM; MRE11A; KRT18; ILF2; FLII; DHX9; DDX1; ABCF1; C14orf166; RPL26L1; IGF2BP3; POLR1C; LRRFIP1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; PRKDC; NMT1; AICDA; FN1; CA9; FAM98B; C2orf49; CAND1; COPS5; CUL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-RTCB (ARP56745_P050) antibody is Catalog # AAP56745 (Previous Catalog # AAPP39603)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
• Uniprot ID: Q9Y3I0
• Protein Name: tRNA-splicing ligase RtcB homolog
• Sample Type Confirmation:

  RTCB is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

• Protein Accession #: NP_055121
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014306
• Tested Species Reactivity: Human
• Gene Symbol: RTCB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Bronchial Epithelial Tissue
  
  Rabbit Anti-RTCB Antibody
  Catalog Number: ARP56745_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2: Human Colon
  
  Rabbit Anti-C22orf28 antibody
  Catalog Number: ARP56745
  Formalin Fixed Paraffin Embedded Tissue: Human Colon
  Primary antibody Concentration: 10 ug/ml
• Image 3: Human Kidney
  
  Rabbit Anti-C22orf28 antibody
  Catalog Number: ARP56745
  Formalin Fixed Paraffin Embedded Tissue: Human Kidney
  Primary antibody Concentration: 10 ug/ml
• Image 4: Human 293T
  
  Host: Rabbit
  Target Name: C22orf28
  Sample Tissue: Human 293T
  Antibody Dilution: 1.0ug/ml