RAGE Antibody - middle region (ARP56744_P050)

Data Sheet
 
Product Number ARP56744_P050
Product Page www.avivasysbio.com/rage-antibody-middle-region-arp56744-p050.html
Name RAGE Antibody - middle region (ARP56744_P050)
Protein Size (# AA) 419 amino acids
Molecular Weight 48kDa
NCBI Gene Id 5891
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MOK protein kinase
Alias Symbols RAGE, RAGE1, STK30, RAGE-1
Peptide Sequence Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
Protein Interactions UBC; WDR18; SDF4; HUWE1; ZNF223; MOK; INSR; MAPK6; MYC; JUN; CCNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MOK (ARP56744_P050) antibody
Blocking Peptide For anti-MOK (ARP56744_P050) antibody is Catalog # AAP56744 (Previous Catalog # AAPP39602)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAGE
Uniprot ID Q9UQ07
Protein Name MAPK/MAK/MRK overlapping kinase
Protein Accession # NP_055041
Purification Affinity Purified
Nucleotide Accession # NM_014226
Tested Species Reactivity Human
Gene Symbol MOK
Predicted Species Reactivity Human, Mouse, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%
Image 1
Human OVCAR-3
WB Suggested Anti-RAGE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Image 2
Human testis tissue
Rabbit Anti-MOK Antibody
Catalog Number: ARP56744_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Cytoplasm in spermatogonia and spermatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com