| Product Number |
ARP56724_P050 |
| Product Page |
www.avivasysbio.com/rp2-antibody-middle-region-arp56724-p050.html |
| Name |
RP2 Antibody - middle region (ARP56724_P050) |
| Protein Size (# AA) |
350 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
6102 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Retinitis pigmentosa 2 (X-linked recessive) |
| Alias Symbols |
XRP2, NME10, TBCCD2, NM23-H10, DELXp11.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Grimwood,J., (2004) Nature 428 (6982), 529-535 |
| Description of Target |
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo |
| Protein Interactions |
UBC; ARL3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RP2 (ARP56724_P050) antibody |
| Blocking Peptide |
For anti-RP2 (ARP56724_P050) antibody is Catalog # AAP56724 (Previous Catalog # AAPP39531) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RP2 |
| Uniprot ID |
O75695 |
| Protein Name |
Protein XRP2 |
| Protein Accession # |
NP_008846 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006003 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-RP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle |
| | Image 2 | Human Brain
 | Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-RP2 antibody (ARP56724_P050) |
|
|
