RAN Antibody - middle region (ARP56714_P050)

Data Sheet
 
Product Number ARP56714_P050
Product Page www.avivasysbio.com/ran-antibody-middle-region-arp56714-p050.html
Name RAN Antibody - middle region (ARP56714_P050)
Protein Size (# AA) 216 amino acids
Molecular Weight 24kDa
NCBI Gene Id 5901
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RAN, member RAS oncogene family
Alias Symbols TC4, Gsp1, ARA24
Peptide Sequence Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Abe,H., (2008) Int. J. Cancer 122 (10), 2391-2397
Description of Target RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an
Protein Interactions NUTF2; FUS; UBC; SUMO2; RANBP2; RANBP9; STAU1; ADRB2; SUMO1; NEDD8; MDM2; ASB16; ASB2; SUZ12; EED; RNF2; rev; PFDN4; PTMA; RANBP1; CDK2; rna1; PAN2; XPO5; VCAM1; RPL7; ITGA4; FN1; ESR1; CFTR; RGPD5; MAGOH; EIF4A3; KPNA2; CSE1L; TRA2B; TNPO1; KPNB1; RCC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RAN (ARP56714_P050) antibody
Blocking Peptide For anti-RAN (ARP56714_P050) antibody is Catalog # AAP56714 (Previous Catalog # AAPP39523)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAN
Uniprot ID P62826
Protein Name GTP-binding nuclear protein Ran
Protein Accession # NP_006316
Purification Affinity Purified
Nucleotide Accession # NM_006325
Tested Species Reactivity Human, Mouse
Gene Symbol RAN
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Image 1
Human Lymph Node
Rabbit Anti-RAN Antibody
Catalog Number: ARP56714_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Nucleus, Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Mouse Spleen
Host: Mouse
Target Name: RAN
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml
Image 3
Human HepG2
WB Suggested Anti-RAN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com