PRPH Antibody - N-terminal region (ARP56707_P050)

Data Sheet
 
Product Number ARP56707_P050
Product Page www.avivasysbio.com/prph-antibody-n-terminal-region-arp56707-p050.html
Name PRPH Antibody - N-terminal region (ARP56707_P050)
Protein Size (# AA) 470 amino acids
Molecular Weight 54kDa
NCBI Gene Id 5630
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Peripherin
Alias Symbols NEF4, PRPH1
Peptide Sequence Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840
Description of Target This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe
Protein Interactions UBC; LNX1; NENF; NDUFS4; MTHFD1; ILF3; HNRNPU; CDH2; CALU; CUL3; VIM; PPP2R2B; PRPH2; MYO5A; LMNB1; KRT15;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRPH (ARP56707_P050) antibody
Blocking Peptide For anti-PRPH (ARP56707_P050) antibody is Catalog # AAP56707 (Previous Catalog # AAPP39516)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH
Uniprot ID P41219
Protein Name Peripherin
Protein Accession # NP_006253
Purification Affinity Purified
Nucleotide Accession # NM_006262
Tested Species Reactivity Human
Gene Symbol PRPH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-PRPH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com