| Product Number |
ARP56690_P050 |
| Product Page |
https://www.avivasysbio.com/plcd1-antibody-n-terminal-region-arp56690-p050.html |
| Name |
PLCD1 Antibody - N-terminal region (ARP56690_P050) |
| Protein Size (# AA) |
756 amino acids |
| Molecular Weight |
86kDa |
| NCBI Gene Id |
5333 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Phospholipase C, delta 1 |
| Alias Symbols |
NDNC3, PLC-III |
| Peptide Sequence |
Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fu,L., (2007) Cancer Res. 67 (22), 10720-10726 |
| Description of Target |
Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution. |
| Protein Interactions |
UBC; PAXIP1; APP; RALA; KPNB1; TGM2; RALB; GAP43; CALM1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLCD1 (ARP56690_P050) antibody |
| Blocking Peptide |
For anti-PLCD1 (ARP56690_P050) antibody is Catalog # AAP56690 (Previous Catalog # AAPP34139) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PLCD1 |
| Uniprot ID |
P51178 |
| Protein Name |
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 |
| Protein Accession # |
NP_006216 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006225 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLCD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-PLCD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain |
|
|
