Product Number |
ARP56676_P050 |
Product Page |
www.avivasysbio.com/penk-antibody-middle-region-arp56676-p050.html |
Name |
PENK Antibody - middle region (ARP56676_P050) |
Protein Size (# AA) |
267 amino acids |
Molecular Weight |
31 kDa |
NCBI Gene Id |
5179 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Proenkephalin |
Alias Symbols |
PE, PENK-A |
Peptide Sequence |
Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nikoshkov,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (2), 786-791 |
Description of Target |
Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK (114-133) and PENK (237-258) increase glutamate release in the stri |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PENK (ARP56676_P050) antibody |
Blocking Peptide |
For anti-PENK (ARP56676_P050) antibody is Catalog # AAP56676 (Previous Catalog # AAPP39429) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PENK |
Uniprot ID |
P01210 |
Protein Name |
Proenkephalin-A |
Protein Accession # |
NP_006202 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006211 |
Tested Species Reactivity |
Human |
Gene Symbol |
PENK |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
|