PENK Antibody - middle region (ARP56676_P050)

Data Sheet
 
Product Number ARP56676_P050
Product Page www.avivasysbio.com/penk-antibody-middle-region-arp56676-p050.html
Name PENK Antibody - middle region (ARP56676_P050)
Protein Size (# AA) 267 amino acids
Molecular Weight 31 kDa
NCBI Gene Id 5179
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proenkephalin
Alias Symbols PE, PENK-A
Peptide Sequence Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nikoshkov,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (2), 786-791
Description of Target Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK (114-133) and PENK (237-258) increase glutamate release in the stri
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PENK (ARP56676_P050) antibody
Blocking Peptide For anti-PENK (ARP56676_P050) antibody is Catalog # AAP56676 (Previous Catalog # AAPP39429)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PENK
Uniprot ID P01210
Protein Name Proenkephalin-A
Protein Accession # NP_006202
Purification Affinity Purified
Nucleotide Accession # NM_006211
Tested Species Reactivity Human
Gene Symbol PENK
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com