| Product Number |
ARP56638_P050 |
| Product Page |
https://www.avivasysbio.com/prkab2-antibody-n-terminal-region-arp56638-p050.html |
| Name |
Prkab2 Antibody - N-terminal region (ARP56638_P050) |
| Protein Size (# AA) |
271 amino acids |
| Molecular Weight |
29kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
64562 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protein kinase, AMP-activated, beta 2 non-catalytic subunit |
| Alias Symbols |
MGC93432 |
| Peptide Sequence |
Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Prkab2 is a component of the AMPK alpha2beta2gamma1 complex which phosphorylates glycogen synthase. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Prkab2 (ARP56638_P050) antibody |
| Blocking Peptide |
For anti-Prkab2 (ARP56638_P050) antibody is Catalog # AAP56638 |
| Uniprot ID |
Q9QZH4 |
| Protein Name |
5'-AMP-activated protein kinase subunit beta-2 |
| Protein Accession # |
NP_072149 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022627 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Prkab2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Prkab2 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
