PRKX Antibody - N-terminal region (ARP56626_P050)

Data Sheet
 
Product Number ARP56626_P050
Product Page www.avivasysbio.com/prkx-antibody-n-terminal-region-arp56626-p050.html
Name PRKX Antibody - N-terminal region (ARP56626_P050)
Protein Size (# AA) 358 amino acids
Molecular Weight 41kDa
NCBI Gene Id 5613
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein kinase, X-linked
Alias Symbols PKX1
Peptide Sequence Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9
Description of Target This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein
Protein Interactions UBC; HSP90AA1; NEDD4L; NEDD4; PKIA; PRKAR1A; PRKAR2A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRKX (ARP56626_P050) antibody
Blocking Peptide For anti-PRKX (ARP56626_P050) antibody is Catalog # AAP56626 (Previous Catalog # AAPP39331)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRKX
Uniprot ID P51817
Protein Name cAMP-dependent protein kinase catalytic subunit PRKX
Protein Accession # NP_005035
Purification Affinity Purified
Nucleotide Accession # NM_005044
Tested Species Reactivity Human
Gene Symbol PRKX
Predicted Species Reactivity Human, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 75%
Image 1
Human HepG2
WB Suggested Anti-PRKX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com