Product Number |
ARP56626_P050 |
Product Page |
https://www.avivasysbio.com/prkx-antibody-n-terminal-region-arp56626-p050.html |
Name |
PRKX Antibody - N-terminal region (ARP56626_P050) |
Protein Size (# AA) |
358 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
5613 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Protein kinase, X-linked |
Alias Symbols |
PKX1 |
Peptide Sequence |
Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9 |
Description of Target |
This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein |
Protein Interactions |
UBC; HSP90AA1; NEDD4L; NEDD4; PKIA; PRKAR1A; PRKAR2A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PRKX (ARP56626_P050) antibody |
Blocking Peptide |
For anti-PRKX (ARP56626_P050) antibody is Catalog # AAP56626 (Previous Catalog # AAPP39331) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKX |
Uniprot ID |
P51817 |
Protein Name |
cAMP-dependent protein kinase catalytic subunit PRKX |
Protein Accession # |
NP_005035 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005044 |
Tested Species Reactivity |
Human |
Gene Symbol |
PRKX |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 75% |
Image 1 | Human HepG2
 | WB Suggested Anti-PRKX Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|