Product Number |
ARP56598_P050 |
Product Page |
www.avivasysbio.com/mybph-antibody-n-terminal-region-arp56598-p050.html |
Name |
MYBPH Antibody - N-terminal region (ARP56598_P050) |
Protein Size (# AA) |
477 amino acids |
Molecular Weight |
52 kDa |
NCBI Gene Id |
4608 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Myosin binding protein H |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002) |
Description of Target |
MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band. |
Protein Interactions |
BAG3; ELAVL1; UBC; MYBPC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MYBPH (ARP56598_P050) antibody |
Blocking Peptide |
For anti-MYBPH (ARP56598_P050) antibody is Catalog # AAP56598 (Previous Catalog # AAPP39305) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH |
Uniprot ID |
Q13203 |
Protein Name |
Myosin-binding protein H |
Publications |
Conti, A. et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim. Biophys. Acta 1842, 99-106 (2014). 24184715 |
Protein Accession # |
NP_004988 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004997 |
Tested Species Reactivity |
Human |
Gene Symbol |
MYBPH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Stomach Tumor
| Host: Rabbit Target Name: MYBPH Sample Tissue: Human Stomach Tumor Antibody Dilution: 1ug/ml |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|