MYBPH Antibody - N-terminal region (ARP56598_P050)

Data Sheet
 
Product Number ARP56598_P050
Product Page www.avivasysbio.com/mybph-antibody-n-terminal-region-arp56598-p050.html
Name MYBPH Antibody - N-terminal region (ARP56598_P050)
Protein Size (# AA) 477 amino acids
Molecular Weight 52 kDa
NCBI Gene Id 4608
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myosin binding protein H
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)
Description of Target MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.
Protein Interactions BAG3; ELAVL1; UBC; MYBPC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYBPH (ARP56598_P050) antibody
Blocking Peptide For anti-MYBPH (ARP56598_P050) antibody is Catalog # AAP56598 (Previous Catalog # AAPP39305)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH
Uniprot ID Q13203
Protein Name Myosin-binding protein H
Publications

Conti, A. et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim. Biophys. Acta 1842, 99-106 (2014). 24184715

Protein Accession # NP_004988
Purification Affinity Purified
Nucleotide Accession # NM_004997
Tested Species Reactivity Human
Gene Symbol MYBPH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Stomach Tumor
Host: Rabbit
Target Name: MYBPH
Sample Tissue: Human Stomach Tumor
Antibody Dilution: 1ug/ml
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com