SH3GL2 Antibody - N-terminal region (ARP56549_P050)

Data Sheet
 
Product Number ARP56549_P050
Product Page https://www.avivasysbio.com/sh3gl2-antibody-n-terminal-region-arp56549-p050.html
Name SH3GL2 Antibody - N-terminal region (ARP56549_P050)
Protein Size (# AA) 352 amino acids
Molecular Weight 40kDa
NCBI Gene Id 6456
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SH3-domain GRB2-like 2
Alias Symbols CNSA2, SH3P4, EEN-B1, SH3D2A
Peptide Sequence Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080
Description of Target SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.
Protein Interactions SH3GL1; UBC; ATXN2; EMD; ARNT2; PAXIP1; APP; IPO11; LRRK2; SH3GL3; SH3GL2; TERF1; DNM3; PTPN23; CD2AP; SYNM; PDCD6IP; DYRK1A; DNM2; DNM1; GSTM3; GCH1; F13A1; PPP1R21; ZXDC; PRR14; TMEM108; DPPA4; DACT1; ZNF219; ZNF580; SH3KBP1; TIAM2; EGFL6; MAST2; PPP6R1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SH3GL2 (ARP56549_P050) antibody
Blocking Peptide For anti-SH3GL2 (ARP56549_P050) antibody is Catalog # AAP56549 (Previous Catalog # AAPP39208)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL2
Uniprot ID Q99962
Protein Name Endophilin-A1
Protein Accession # NP_003017
Purification Affinity Purified
Nucleotide Accession # NM_003026
Tested Species Reactivity Human, Rat
Gene Symbol SH3GL2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Rat Brain
Host: Rabbit
Target Name: SH3GL2
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml
Image 2
Rat Brain
Host: Rat
Target Name: SH3GL2
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml
Image 3
Human Placenta
WB Suggested Anti-SH3GL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta