PSMD1 Antibody - N-terminal region (ARP56477_P050)

Data Sheet
 
Product Number ARP56477_P050
Product Page www.avivasysbio.com/psmd1-antibody-n-terminal-region-arp56477-p050.html
Name PSMD1 Antibody - N-terminal region (ARP56477_P050)
Protein Size (# AA) 953 amino acids
Molecular Weight 106kDa
Subunit 1
NCBI Gene Id 5707
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
Alias Symbols S1, P112, Rpn2
Peptide Sequence Synthetic peptide located within the following region: HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a
Protein Interactions HUWE1; UBC; SUMO2; SNAI2; PSMD14; TXNL1; PPFIA1; RPS28; RPS21; RPS15A; RPS12; RPS8; UCHL5; ADRM1; PSMD12; PSMD11; PSMD8; PSMD4; PSMD3; PSMD2; PSMC6; PSMC5; PSMC3; PSMC2; PSMC1; PARK2; GSK3A; CDK11A; CDK20; ICK; RNF11; HDAC6; NPM1; PSMB7; SMAD1; HSP90AB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PSMD1 (ARP56477_P050) antibody
Blocking Peptide For anti-PSMD1 (ARP56477_P050) antibody is Catalog # AAP56477 (Previous Catalog # AAPP38932)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD1
Uniprot ID Q99460
Protein Name 26S proteasome non-ATPase regulatory subunit 1
Protein Accession # NP_002798
Purification Affinity Purified
Nucleotide Accession # NM_002807
Tested Species Reactivity Human
Gene Symbol PSMD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-PSMD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com