PRELP Antibody - middle region (ARP56412_P050)

Data Sheet
 
Product Number ARP56412_P050
Product Page www.avivasysbio.com/prelp-antibody-middle-region-arp56412-p050.html
Name PRELP Antibody - middle region (ARP56412_P050)
Protein Size (# AA) 382 amino acids
Molecular Weight 42kDa
NCBI Gene Id 5549
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proline/arginine-rich end leucine-rich repeat protein
Alias Symbols MST161, SLRR2A, MSTP161
Peptide Sequence Synthetic peptide located within the following region: SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Grover,J., (2007) Matrix Biol. 26 (2), 140-143
Description of Target PRELP is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage.The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed.
Protein Interactions Dlg4; HSPG2; FBLN2; FN1; NID1; COL1A1; COL2A1; NID2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRELP (ARP56412_P050) antibody
Blocking Peptide For anti-PRELP (ARP56412_P050) antibody is Catalog # AAP56412 (Previous Catalog # AAPP34209)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRELP
Uniprot ID P51888
Protein Name Prolargin
Protein Accession # NP_002716
Purification Affinity Purified
Nucleotide Accession # NM_002725
Tested Species Reactivity Human
Gene Symbol PRELP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Image 1
Transfected 293T
WB Suggested Anti-PRELP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com