PMM1 Antibody - N-terminal region (ARP56401_P050)

Data Sheet
 
Product Number ARP56401_P050
Product Page www.avivasysbio.com/pmm1-antibody-n-terminal-region-arp56401-p050.html
Name PMM1 Antibody - N-terminal region (ARP56401_P050)
Protein Size (# AA) 262 amino acids
Molecular Weight 30kDa
NCBI Gene Id 5372
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Phosphomannomutase 1
Alias Symbols PMM 1, Sec53, PMMH-22
Peptide Sequence Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)
Description of Target Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat
Protein Interactions RAB6A; UBC; RCHY1; CACNA1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PMM1 (ARP56401_P050) antibody
Blocking Peptide For anti-PMM1 (ARP56401_P050) antibody is Catalog # AAP56401 (Previous Catalog # AAPP38714)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1
Uniprot ID Q92871
Protein Name Phosphomannomutase 1
Protein Accession # NP_002667
Purification Affinity Purified
Nucleotide Accession # NM_002676
Tested Species Reactivity Human
Gene Symbol PMM1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 79%
Image 1
Human 293T
WB Suggested Anti-PMM1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com