PLEK Antibody - N-terminal region : HRP (ARP56397_P050-HRP)

Data Sheet
 
Product Number ARP56397_P050-HRP
Product Page www.avivasysbio.com/plek-antibody-n-terminal-region-hrp-arp56397-p050-hrp.html
Name PLEK Antibody - N-terminal region : HRP (ARP56397_P050-HRP)
Protein Size (# AA) 350 amino acids
Molecular Weight 40kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 5341
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pleckstrin
Alias Symbols P47
Peptide Sequence Synthetic peptide located within the following region: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Hillier,L.W., (2005) Nature 434 (7034), 724-731
Description of Target PLEK is a major protein kinase C substrate of platelets, its exact function is not known.
Protein Interactions UBC; PLEK; INPP5A; TGFBR1; ACVR1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PLEK (ARP56397_P050-HRP) antibody
Blocking Peptide For anti-PLEK (ARP56397_P050-HRP) antibody is Catalog # AAP56397 (Previous Catalog # AAPP38710)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK
Uniprot ID P08567
Protein Name Pleckstrin
Protein Accession # NP_002655
Purification Affinity Purified
Nucleotide Accession # NM_002664
Gene Symbol PLEK
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com