MAGEB3 Antibody - N-terminal region (ARP56338_P050)

Data Sheet
 
Product Number ARP56338_P050
Product Page www.avivasysbio.com/mageb3-antibody-n-terminal-region-arp56338-p050.html
Name MAGEB3 Antibody - N-terminal region (ARP56338_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 39kDa
NCBI Gene Id 4114
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Melanoma antigen family B, 3
Alias Symbols CT3.5
Peptide Sequence Synthetic peptide located within the following region: MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ross,M.T., (2005) Nature 434 (7031), 325-337
Description of Target This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MAGEB3 (ARP56338_P050) antibody
Blocking Peptide For anti-MAGEB3 (ARP56338_P050) antibody is Catalog # AAP56338 (Previous Catalog # AAPP38347)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB3
Uniprot ID O15480
Protein Name Melanoma-associated antigen B3
Protein Accession # NP_002356
Purification Affinity Purified
Nucleotide Accession # NM_002365
Tested Species Reactivity Human
Gene Symbol MAGEB3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 77%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 77%; Rabbit: 79%; Rat: 77%
Image 1
Human Brain
WB Suggested Anti-MAGEB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com