ATP6V1B2 Antibody - N-terminal region (ARP56328_P050)

Data Sheet
 
Product Number ARP56328_P050
Product Page www.avivasysbio.com/atp6v1b2-antibody-n-terminal-region-arp56328-p050.html
Name ATP6V1B2 Antibody - N-terminal region (ARP56328_P050)
Protein Size (# AA) 511 amino acids
Molecular Weight 56kDa
Subunit B, brain isoform
NCBI Gene Id 526
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
Alias Symbols DOOD, HO57, VATB, VPP3, Vma2, ZLS2, ATP6B2, ATP6B1B2
Peptide Sequence Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chi,A., (2006) J. Proteome Res. 5 (11), 3135-3144
Description of Target ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions TCF4; UBC; PBDC1; GMPPB; GANAB; SWAP70; MSH2; JUP; MSH6; XRCC6; CRMP1; HYOU1; SEC24C; CUL2; SUPT5H; SSRP1; PDE3A; CSDE1; PAN2; FN1; SRXN1; YIF1B; UNK; ZFYVE19; TUBA1C; INTS2; TRMT1; ABCF3; ATP6V1H; CCT8; SSSCA1; TUBB4B; UBA2; USP34; ATP6V1F; ZBED1; ZPR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATP6V1B2 (ARP56328_P050) antibody
Blocking Peptide For anti-ATP6V1B2 (ARP56328_P050) antibody is Catalog # AAP56328 (Previous Catalog # AAPP35501)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1B2
Uniprot ID P21281
Protein Name V-type proton ATPase subunit B, brain isoform
Protein Accession # NP_001684
Purification Affinity Purified
Nucleotide Accession # NM_001693
Tested Species Reactivity Human, Mouse
Gene Symbol ATP6V1B2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
mouse brain extract
WB Suggested Anti-ATP6V1B2 Antibody
Positive Control: Lane 1: 80ug mouse brain extract
Primary Antibody Dilution : 1:500
Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience
Secondry Antibody Dilution : 1:20,000
Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Image 2
Human 721_B
WB Suggested Anti-ATP6V1B2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com