ACO2 Antibody - N-terminal region (ARP56301_P050)

• Product Number: ARP56301_P050
• Name: ACO2 Antibody - N-terminal region (ARP56301_P050)
• Protein Size (# AA): 780 amino acids
• Molecular Weight: 82kDa
• NCBI Gene Id: 50
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Aconitase 2, mitochondrial
• Alias Symbols: ICRD, OCA8, OPA9, ACONM, HEL-S-284
• Peptide Sequence: Synthetic peptide located within the following region: LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yu,Z., (2006) Prostate 66 (10), 1061-1069
• Description of Target: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SUMO2; UBC; SUMO1; NEDD8; MDM2; ASB9; VCAM1; ITGA4; AK3; SIN3A; ACAA2; APP; ACAT1; ATXN1L; SUMO4; PSMD4; SRRM2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACO2 (ARP56301_P050) antibody is Catalog # AAP56301 (Previous Catalog # AAPP34417)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACO2
• Uniprot ID: Q99798
• Protein Name: Aconitate hydratase, mitochondrial
• Publications:

  Freund, D. M., Prenni, J. E. & Curthoys, N. P. Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis. Am. J. Physiol. Renal Physiol. 304, F145-55 (2013). 23136003

  Schauer, K. L., Freund, D. M., Prenni, J. E. & Curthoys, N. P. Proteomic profiling and pathway analysis of the response of rat renal proximal convoluted tubules to metabolic acidosis. Am. J. Physiol. Renal Physiol. 305, F628-40 (2013). 23804448

• Sample Type Confirmation:

  ACO2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_001089
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001098
• Tested Species Reactivity: Human, Rat
• Gene Symbol: ACO2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%
• Image 1: Rat kidney
  
  ACO2 antibody - N-terminal region (ARP56301_P050) validated by WB using Proximal kidney tubules purfied from cortex at 5.0ug/ml.
• Image 2: Human 721_B
  
  WB Suggested Anti-ACO2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 721_B cell lysateACO2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells