SELENOP Antibody - N-terminal region (ARP56299_P050)

• Product Number: ARP56299_P050
• Name: SELENOP Antibody - N-terminal region (ARP56299_P050)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 43 kDa
• NCBI Gene Id: 6414
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: selenoprotein P
• Alias Symbols: SeP, SELP, SEPP, SEPP1
• Peptide Sequence: Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
• Description of Target: This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of the selenium in plasma. It has been implicated as an extracellular antioxidant, and in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2). Mice lacking this gene exhibit neurological dysfunction, suggesting its importance in normal brain function. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The mRNA for this selenoprotein contains two SECIS elements. Alternatively spliced transcript variants have been found for this gene.
• Protein Interactions: EP300; MEOX2; THRA; EGFR;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SELENOP (ARP56299_P050) antibody is Catalog # AAP56299 (Previous Catalog # AAPP35502)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPP1
• Uniprot ID: P49908
• Protein Name: selenoprotein P
• Sample Type Confirmation:

  SEPP1 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_001087195
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001093726
• Tested Species Reactivity: Human
• Gene Symbol: SELENOP
• Predicted Species Reactivity: Human, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 85%; Human: 100%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.