| Product Number |
ARP56290_P050-HRP |
| Product Page |
https://www.avivasysbio.com/kiaa1191-antibody-middle-region-hrp-arp56290-p050-hrp.html |
| Name |
KIAA1191 Antibody - middle region : HRP (ARP56290_P050-HRP) |
| Protein Size (# AA) |
305 amino acids |
| Molecular Weight |
33kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
57179 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
KIAA1191 |
| Alias Symbols |
p33MONOX, p60MONOX |
| Peptide Sequence |
Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Zuhlke,C., (1999) DNA Seq. 10 (1), 1-6 |
| Description of Target |
The specific function of this protein remains unknown. |
| Protein Interactions |
APP; PRNP; POT1; GSK3B; CACNA1A; SNCA; NOL12; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-KIAA1191 (ARP56290_P050-HRP) antibody |
| Blocking Peptide |
For anti-KIAA1191 (ARP56290_P050-HRP) antibody is Catalog # AAP56290 (Previous Catalog # AAPP38309) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KIAA1191 |
| Uniprot ID |
Q96A73 |
| Protein Name |
Putative monooxygenase p33MONOX |
| Protein Accession # |
NP_001073153 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001079685 |
| Gene Symbol |
KIAA1191 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 79% |
| Image 1 | |
|
