| Product Number |
ARP56238_P050 |
| Product Page |
www.avivasysbio.com/faim-antibody-middle-region-arp56238-p050.html |
| Name |
FAIM Antibody - middle region (ARP56238_P050) |
| Protein Size (# AA) |
213 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
55179 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Fas apoptotic inhibitory molecule |
| Alias Symbols |
FAIM1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241 |
| Description of Target |
FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells. |
| Protein Interactions |
SPRY2; UBC; XIAP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FAIM (ARP56238_P050) antibody |
| Blocking Peptide |
For anti-FAIM (ARP56238_P050) antibody is Catalog # AAP56238 (Previous Catalog # AAPP38207) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FAIM |
| Uniprot ID |
Q9NVQ4 |
| Protein Name |
Fas apoptotic inhibitory molecule 1 |
| Sample Type Confirmation |
FAIM is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_001028202 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033030 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FAIM |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysateFAIM is supported by BioGPS gene expression data to be expressed in OVCAR3 |
|
