Product Number |
ARP56220_P050 |
Product Page |
www.avivasysbio.com/hist2h2bf-antibody-n-terminal-region-arp56220-p050.html |
Name |
HIST2H2BF Antibody - N-terminal region (ARP56220_P050) |
Protein Size (# AA) |
126 amino acids |
Molecular Weight |
14kDa |
NCBI Gene Id |
440689 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Histone cluster 2, H2bf |
Alias Symbols |
HIST2H2BF |
Peptide Sequence |
Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kim,S.C., (2006) Mol. Cell 23 (4), 607-618 |
Description of Target |
HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Protein Interactions |
SPRTN; UBC; rev; IGSF8; ICAM1; CD81; ITGA4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HIST2H2BF (ARP56220_P050) antibody |
Blocking Peptide |
For anti-HIST2H2BF (ARP56220_P050) antibody is Catalog # AAP56220 (Previous Catalog # AAPP38138) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF |
Uniprot ID |
Q5QNW6 |
Protein Name |
Histone H2B type 2-F |
Protein Accession # |
NP_001019770 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001024599 |
Tested Species Reactivity |
Human |
Gene Symbol |
HIST2H2BF |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
CHIP, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Small Intestine
| WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Small Intestine |
| Image 2 | HCT116
| Chromatin Immunoprecipitation (ChIP) Using HIST2H2BF antibody - N-terminal region (ARP56220_P050) and HCT116 Cells |
|
|