HIST2H2BF Antibody - N-terminal region (ARP56220_P050)

Data Sheet
 
Product Number ARP56220_P050
Product Page www.avivasysbio.com/hist2h2bf-antibody-n-terminal-region-arp56220-p050.html
Name HIST2H2BF Antibody - N-terminal region (ARP56220_P050)
Protein Size (# AA) 126 amino acids
Molecular Weight 14kDa
NCBI Gene Id 440689
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Histone cluster 2, H2bf
Alias Symbols HIST2H2BF
Peptide Sequence Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,S.C., (2006) Mol. Cell 23 (4), 607-618
Description of Target HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Protein Interactions SPRTN; UBC; rev; IGSF8; ICAM1; CD81; ITGA4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HIST2H2BF (ARP56220_P050) antibody
Blocking Peptide For anti-HIST2H2BF (ARP56220_P050) antibody is Catalog # AAP56220 (Previous Catalog # AAPP38138)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF
Uniprot ID Q5QNW6
Protein Name Histone H2B type 2-F
Protein Accession # NP_001019770
Purification Affinity Purified
Nucleotide Accession # NM_001024599
Tested Species Reactivity Human
Gene Symbol HIST2H2BF
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application CHIP, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Small Intestine
WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
Image 2
HCT116
Chromatin Immunoprecipitation (ChIP) Using HIST2H2BF antibody - N-terminal region (ARP56220_P050) and HCT116 Cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com