RTKN Antibody - middle region (ARP56211_P050)

Data Sheet
 
Product Number ARP56211_P050
Product Page www.avivasysbio.com/rtkn-antibody-middle-region-arp56211-p050.html
Name RTKN Antibody - middle region (ARP56211_P050)
Protein Size (# AA) 563 amino acids
Molecular Weight 63kDa
NCBI Gene Id 6242
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rhotekin
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sudo,K., (2007) Hum. Mutat. 28 (10), 1005-1013
Description of Target RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Interactions YWHAB; RHO1; APP; RHOA; UBC; TAX1BP3; SMURF1; GOPC; RAC2; TGFBR1; RHOC; RTN4R;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RTKN (ARP56211_P050) antibody
Blocking Peptide For anti-RTKN (ARP56211_P050) antibody is Catalog # AAP56211 (Previous Catalog # AAPP38130)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RTKN
Uniprot ID Q9BST9
Protein Name Rhotekin
Protein Accession # NP_001015055
Purification Affinity Purified
Nucleotide Accession # NM_001015055
Tested Species Reactivity Human
Gene Symbol RTKN
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human 293T
WB Suggested Anti-RTKN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com