RPS7 Antibody - N-terminal region (ARP56147_P050)

Data Sheet
 
Product Number ARP56147_P050
Product Page www.avivasysbio.com/rps7-antibody-n-terminal-region-arp56147-p050.html
Name RPS7 Antibody - N-terminal region (ARP56147_P050)
Protein Size (# AA) 194 amino acids
Molecular Weight 22kDa
NCBI Gene Id 6201
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribosomal protein S7
Alias Symbols S7, eS7, DBA8
Peptide Sequence Synthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen,D., (2007) Oncogene 26 (35), 5029-5037
Description of Target RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions RPS3; MDM2; HUWE1; ZBTB14; UBC; TP53; CEP76; TUBGCP3; CEP57; CDC37L1; RPA3; RPA2; RPA1; RNF2; EED; FAU; DDX3X; PSMC4; WIBG; EIF2A; WDR26; PNO1; TSR1; RPS27L; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPS7 (ARP56147_P050) antibody
Blocking Peptide For anti-RPS7 (ARP56147_P050) antibody is Catalog # AAP56147 (Previous Catalog # AAPP37920)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPS7
Uniprot ID P62081
Protein Name 40S ribosomal protein S7
Protein Accession # NP_001002
Purification Affinity Purified
Nucleotide Accession # NM_001011
Tested Species Reactivity Human
Gene Symbol RPS7
Predicted Species Reactivity Human, Mouse, Rat, Dog, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Placenta
WB Suggested Anti-RPS7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com