RPL18 Antibody - C-terminal region : FITC (ARP56128_P050-FITC)

Data Sheet
 
Product Number ARP56128_P050-FITC
Product Page www.avivasysbio.com/rpl18-antibody-c-terminal-region-fitc-arp56128-p050-fitc.html
Name RPL18 Antibody - C-terminal region : FITC (ARP56128_P050-FITC)
Protein Size (# AA) 188 amino acids
Molecular Weight 20kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 6141
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols L18, DBA18
Peptide Sequence Synthetic peptide located within the following region: QLALDSPKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18E family of ribosomal proteins that is a component of the 60S subunit. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Interactions UBC; FUS; HUWE1; CEP250; TP53; STAU1; MDM2; ZBTB1; RPA3; RPA2; RPA1; EED; RPLP0; RPL24; RPL23A; RPL13; IARS; FAU; NUDT21; EEF1E1; FBXO6; ICAM1; IGSF8; PAN2; ITGA4; IL7R; FN1; ESR1; CDKN1A; UBL4A; VCAM1; PA2G4; MAGOH; EIF4A3; RPS5; RPS4X; RPS3A; RPS3; RPS2
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-RPL18 (ARP56128_P050-FITC) antibody
Blocking Peptide For anti-RPL18 (ARP56128_P050-FITC) antibody is Catalog # AAP56128
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL18
Uniprot ID Q07020
Protein Accession # NP_000970
Purification Affinity Purified
Gene Symbol RPL18
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com