RPL18 Antibody - N-terminal region (ARP56127_P050)

• Product Number: ARP56127_P050
• Name: RPL18 Antibody - N-terminal region (ARP56127_P050)
• Protein Size (# AA): 188 amino acids
• Molecular Weight: 22kDa
• NCBI Gene Id: 6141
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ribosomal protein L18
• Alias Symbols: L18, DBA18
• Peptide Sequence: Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292
• Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; FUS; HUWE1; CEP250; TP53; STAU1; MDM2; ZBTB1; RPA3; RPA2; RPA1; EED; RPLP0; RPL24; RPL23A; RPL13; IARS; FAU; NUDT21; EEF1E1; FBXO6; ICAM1; IGSF8; PAN2; ITGA4; IL7R; FN1; ESR1; CDKN1A; UBL4A; VCAM1; PA2G4; MAGOH; EIF4A3; RPS5; RPS4X; RPS3A; RPS3; RPS2
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RPL18 (ARP56127_P050) antibody is Catalog # AAP56127 (Previous Catalog # AAPP37748)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPL18
• Uniprot ID: Q07020
• Protein Name: 60S ribosomal protein L18
• Sample Type Confirmation:

  RPL18 is supported by BioGPS gene expression data to be expressed in HT1080

• Protein Accession #: NP_000970
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000979
• Tested Species Reactivity: Human
• Gene Symbol: RPL18
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HT1080
  
  WB Suggested Anti-RPL18 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HT1080 cell lysateRPL18 is supported by BioGPS gene expression data to be expressed in HT1080
• Image 2: Human Adult Liver
  
  Rabbit Anti-RPL18 Antibody
  Catalog Number: ARP56127_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, very strong signal, low tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.