| Product Number |
ARP56116_P050 |
| Product Page |
https://www.avivasysbio.com/pccb-antibody-middle-region-arp56116-p050.html |
| Name |
PCCB Antibody - middle region (ARP56116_P050) |
| Protein Size (# AA) |
539 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
5096 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Propionyl CoA carboxylase, beta polypeptide |
| Alias Symbols |
DKFZp451E113 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997 |
| Description of Target |
PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2). |
| Protein Interactions |
HUWE1; PARK2; IFIT1; INPPL1; EPS15; UBE2N; UBC; EBNA-LP; ICT1; PCCB; PCCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PCCB (ARP56116_P050) antibody |
| Blocking Peptide |
For anti-PCCB (ARP56116_P050) antibody is Catalog # AAP56116 (Previous Catalog # AAPP37737) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PCCB |
| Uniprot ID |
P05166 |
| Protein Name |
Propionyl-CoA carboxylase beta chain, mitochondrial |
| Protein Accession # |
NP_000523 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000532 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PCCB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-PCCB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain |
|
