PCCB Antibody - middle region (ARP56116_P050)

Data Sheet
 
Product Number ARP56116_P050
Product Page www.avivasysbio.com/pccb-antibody-middle-region-arp56116-p050.html
Name PCCB Antibody - middle region (ARP56116_P050)
Protein Size (# AA) 539 amino acids
Molecular Weight 58kDa
NCBI Gene Id 5096
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Propionyl CoA carboxylase, beta polypeptide
Alias Symbols DKFZp451E113
Peptide Sequence Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997
Description of Target PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).
Protein Interactions HUWE1; PARK2; IFIT1; INPPL1; EPS15; UBE2N; UBC; EBNA-LP; ICT1; PCCB; PCCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PCCB (ARP56116_P050) antibody
Blocking Peptide For anti-PCCB (ARP56116_P050) antibody is Catalog # AAP56116 (Previous Catalog # AAPP37737)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PCCB
Uniprot ID P05166
Protein Name Propionyl-CoA carboxylase beta chain, mitochondrial
Protein Accession # NP_000523
Purification Affinity Purified
Nucleotide Accession # NM_000532
Tested Species Reactivity Human
Gene Symbol PCCB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human Brain
WB Suggested Anti-PCCB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com