| Product Number |
ARP56030_P050 |
| Product Page |
www.avivasysbio.com/alox15-antibody-middle-region-arp56030-p050.html |
| Name |
ALOX15 Antibody - middle region (ARP56030_P050) |
| Protein Size (# AA) |
662 amino acids |
| Molecular Weight |
73kDa |
| NCBI Gene Id |
246 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Arachidonate 15-lipoxygenase |
| Alias Symbols |
LOG15, 12-LOX, 15-LOX, 15-LOX-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453 |
| Description of Target |
ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALOX15 (ARP56030_P050) antibody |
| Blocking Peptide |
For anti-ALOX15 (ARP56030_P050) antibody is Catalog # AAP56030 (Previous Catalog # AAPP37435) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ALOX15 |
| Uniprot ID |
P16050 |
| Protein Name |
Arachidonate 15-lipoxygenase |
| Publications |
The whole-genome expression analysis of peripheral blood mononuclear cells from aspirin sensitive asthmatics versus aspirin tolerant patients and healthy donors after in vitro aspirin challenge. Respir. Res. 16, 147 (2015). 26646719 |
| Protein Accession # |
NP_001131 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001140 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALOX15 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 85% |
| Image 1 | Human Heart
 | WB Suggested Anti-ALOX15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
| Image 2 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: ALOX15
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml |
|
