| Product Number |
ARP56027_P050 |
| Product Page |
www.avivasysbio.com/rsph10b-antibody-middle-region-arp56027-p050.html |
| Name |
RSPH10B Antibody - middle region (ARP56027_P050) |
| Protein Size (# AA) |
870 amino acids |
| Molecular Weight |
96kDa |
| NCBI Gene Id |
222967 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Radial spoke head 10 homolog B (Chlamydomonas) |
| Alias Symbols |
MGC50833, RSPH10B2 |
| Peptide Sequence |
Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yang,P., J. Cell. Sci. 119 (PT 6), 1165-1174 (2006) |
| Description of Target |
The specific function of the protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RSPH10B (ARP56027_P050) antibody |
| Blocking Peptide |
For anti-RSPH10B (ARP56027_P050) antibody is Catalog # AAP56027 (Previous Catalog # AAPP37432) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RSPH10B |
| Uniprot ID |
B2RC85 |
| Protein Name |
Radial spoke head 10 homolog B2 |
| Protein Accession # |
NP_775836 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173565 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RSPH10B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 91% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RSPH10B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
