| Product Number |
ARP56003_P050 |
| Product Page |
www.avivasysbio.com/c2orf55-antibody-middle-region-arp56003-p050.html |
| Name |
C2orf55 Antibody - middle region (ARP56003_P050) |
| Protein Size (# AA) |
962 amino acids |
| Molecular Weight |
102kDa |
| NCBI Gene Id |
343990 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 2 open reading frame 55 |
| Alias Symbols |
C2orf55, KIAA1211L |
| Peptide Sequence |
Synthetic peptide located within the following region: ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The specific function of the protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIAA1211L (ARP56003_P050) antibody |
| Blocking Peptide |
For anti-KIAA1211L (ARP56003_P050) antibody is Catalog # AAP56003 (Previous Catalog # AAPP37409) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C2orf55 |
| Uniprot ID |
Q6NV74 |
| Protein Name |
Uncharacterized protein KIAA1211-like |
| Protein Accession # |
NP_997245 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207362 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIAA1211L |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Horse: 77%; Human: 100%; Rabbit: 79%; Rat: 79% |
| Image 1 | Human Placenta
 | WB Suggested Anti-C2orf55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta |
|
|
