ZDHHC24 Antibody - middle region (ARP55989_P050)

Data Sheet
 
Product Number ARP55989_P050
Product Page www.avivasysbio.com/zdhhc24-antibody-middle-region-arp55989-p050.html
Name ZDHHC24 Antibody - middle region (ARP55989_P050)
Protein Size (# AA) 284 amino acids
Molecular Weight 30kDa
NCBI Gene Id 254359
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger, DHHC-type containing 24
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Description of Target The specific function of the protein remains unknown.
Protein Interactions TCF4; REL;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZDHHC24 (ARP55989_P050) antibody
Blocking Peptide For anti-ZDHHC24 (ARP55989_P050) antibody is Catalog # AAP55989 (Previous Catalog # AAPP37336)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC24
Uniprot ID Q6UX98
Protein Name Probable palmitoyltransferase ZDHHC24
Protein Accession # NP_997223
Purification Affinity Purified
Nucleotide Accession # NM_207340
Tested Species Reactivity Human
Gene Symbol ZDHHC24
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rat: 100%
Image 1
Human Small Intestine
WB Suggested Anti-ZDHHC24 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com