NUP43 Antibody - middle region (ARP55922_P050)

Data Sheet
 
Product Number ARP55922_P050
Product Page www.avivasysbio.com/nup43-antibody-middle-region-arp55922-p050.html
Name NUP43 Antibody - middle region (ARP55922_P050)
Protein Size (# AA) 380 amino acids
Molecular Weight 42kDa
NCBI Gene Id 348995
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nucleoporin 43kDa
Alias Symbols p42, bA350J20.1
Peptide Sequence Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Description of Target NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630
Protein Interactions UBC; SUMO1; SEH1L; DCTN2; TP53RK; RAB3GAP2; NUP107; UBD; ISG15; CUL4A; DDB1; Nup98; NUP37; NUP85; NUP133; NUP160;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUP43 (ARP55922_P050) antibody
Blocking Peptide For anti-NUP43 (ARP55922_P050) antibody is Catalog # AAP55922 (Previous Catalog # AAPP37212)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NUP43
Uniprot ID Q8NFH3
Protein Name Nucleoporin Nup43
Protein Accession # NP_942590
Purification Affinity Purified
Nucleotide Accession # NM_198887
Tested Species Reactivity Human
Gene Symbol NUP43
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Thymus
WB Suggested Anti-NUP43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus
Image 2
HEK293 Whole Cell Lysate
NUP43 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP55922_P050 with 1:200 dilution. Western blot was performed using ARP55922_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: NUP43 IP with ARP55922_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com