RAB15 Antibody - N-terminal region (ARP55917_P050)

• Product Number: ARP55917_P050
• Name: RAB15 Antibody - N-terminal region (ARP55917_P050)
• Protein Size (# AA): 208 amino acids
• Molecular Weight: 23kDa
• NCBI Gene Id: 376267
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: RAB15, member RAS oncogene family
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strick,D.J. (2005) Mol. Biol. Cell 16 (12), 5699-5709
• Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.
• Protein Interactions: UBL4A; UBC; CDK2; RPH3A; RABIF;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RAB15 (ARP55917_P050) antibody is Catalog # AAP55917 (Previous Catalog # AAPP37207)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB15
• Uniprot ID: P59190-2
• Protein Name: Ras-related protein Rab-15
• Protein Accession #: NP_941959
• Purification: Affinity Purified
• Nucleotide Accession #: NM_198686
• Tested Species Reactivity: Human
• Gene Symbol: RAB15
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human THP-1
  
  WB Suggested Anti-RAB15 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: THP-1 cell lysate