| Product Number |
ARP55903_P050 |
| Product Page |
https://www.avivasysbio.com/c3orf62-antibody-middle-region-arp55903-p050.html |
| Name |
C3orf62 Antibody - middle region (ARP55903_P050) |
| Protein Size (# AA) |
267 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
375341 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chromosome 3 open reading frame 62 |
| Alias Symbols |
MAPS |
| Peptide Sequence |
Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
The specific function of the protein remains unknown. |
| Protein Interactions |
HAUS1; MRFAP1L1; MRFAP1; ING5; TXNDC9; DGCR6; APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C3orf62 (ARP55903_P050) antibody |
| Blocking Peptide |
For anti-C3orf62 (ARP55903_P050) antibody is Catalog # AAP55903 (Previous Catalog # AAPP37131) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C3orf62 |
| Uniprot ID |
Q6ZUJ4 |
| Protein Name |
Uncharacterized protein C3orf62 |
| Protein Accession # |
NP_940964 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198562 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C3orf62 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-C3orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate |
|
|
